PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK11483.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 524aa    MW: 57900.4 Da    PI: 5.2924
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK11483.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS414.87.6e-1271625231373
       GRAS   1 lvelLlecAeavssgdlelaqalLarlsel..aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                lv+ Ll+cAe v+ gdl  a++l+++++ l  + +    + ++a yf  AL++r+++   ++     + +      ++e   +  ++e++P+lkf+h+ta
  PK11483.1 162 LVHMLLTCAESVQRGDLPFARSLIETMQPLlkRVNINCGIGKVAGYFIDALSRRIFSPRGSI----GAGPF-----EDE-VLYYHYYEACPYLKFAHFTA 251
                689*************************99644444579*****************922222....22222.....233.345579************** PP

       GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                NqaIlea++g+++vH+iDf++++GlQWpaL+qaLa Rp+gpp lR+Tg+g+p+++ +++l+e+g rLa++A++++v+f f+ ++a+rled+++++L+v++
  PK11483.1 252 NQAILEAFNGHDCVHVIDFNLMHGLQWPALIQALALRPGGPPLLRLTGIGPPSPDGRDSLREIGLRLADLAKSVNVRFAFRGVAAERLEDVKPWMLQVSS 351
                **************************************************************************************************** PP

       GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                +Ea+aVn+++qlhrll +++s +s +d vL+ +++l+Pk+++vveqeadhn+  Fl+rf+eal+yys++fdslea      + ++ + +++l+rei+nvv
  PK11483.1 352 KEAVAVNSIMQLHRLLGSDHSWNSGIDMVLEWIRNLNPKIMTVVEQEADHNQVGFLDRFTEALYYYSTMFDSLEAC---SLQPDKALAEMYLQREICNVV 448
                *************************************************************************998...348888889999********* PP

       GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                +ceg++r+erhe l+kW +rl +aGF+p++l+++a kqa++ll  ++ +gy vee++g+l+lgW++rpL+++SaW
  PK11483.1 449 CCEGSARVERHEPLAKWTNRLVQAGFQPLHLGSNAFKQASMLLTLFSAEGYCVEEKEGCLTLGWHSRPLIAASAW 523
                *************************************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011291.0E-2333106No hitNo description
PfamPF120414.3E-343399IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098561.853136504IPR005202Transcription factor GRAS
PfamPF035142.6E-124162523IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 524 aa     Download sequence    Send to blast
MGPYDSANSA GSSSSSGSSS SSSTSFKKPN DIDGFLAGAG YKVRSSDLQH VAQRLEQLET  60
VMVNSPASQI NHIASDTVHY NPSDISSWVD SLLSELNNPF PLSADLPDFP DLVINNPTER  120
NDVWAAEHGV PQPQQNIPPT PQLNQQPLTV VTAMEEDSGI RLVHMLLTCA ESVQRGDLPF  180
ARSLIETMQP LLKRVNINCG IGKVAGYFID ALSRRIFSPR GSIGAGPFED EVLYYHYYEA  240
CPYLKFAHFT ANQAILEAFN GHDCVHVIDF NLMHGLQWPA LIQALALRPG GPPLLRLTGI  300
GPPSPDGRDS LREIGLRLAD LAKSVNVRFA FRGVAAERLE DVKPWMLQVS SKEAVAVNSI  360
MQLHRLLGSD HSWNSGIDMV LEWIRNLNPK IMTVVEQEAD HNQVGFLDRF TEALYYYSTM  420
FDSLEACSLQ PDKALAEMYL QREICNVVCC EGSARVERHE PLAKWTNRLV QAGFQPLHLG  480
SNAFKQASML LTLFSAEGYC VEEKEGCLTL GWHSRPLIAA SAWX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-5320352342374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009371410.10.0PREDICTED: DELLA protein GAI-like
SwissprotQ9LQT81e-164GAI_ARATH; DELLA protein GAI
TrEMBLQ0HA680.0Q0HA68_MALDO; DELLA protein
STRINGVIT_11s0016g04630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-145GRAS family protein